Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Kua-UEV polyclonal antibody (A01)

  • Catalog # : H00387522-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant Kua-UEV.
  • Immunogen:
  • Kua-UEV (NP_954673, 94 a.a. ~ 164 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00387522-A01
    Western Blot detection against Immunogen (33.92 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TMEM189-UBE2V1
  • Gene Alias:
  • CROC-1B,Kua-UEV,UBE2V1
  • Gene Description:
  • TMEM189-UBE2V1 readthrough transcript
  • Gene Summary:
  • The TMEM189-UEV mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this co-transcribed mRNA and the function of its protein product has not yet been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031797,ubiquitin-conjugating enzyme E2 variant 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook