Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPR154 (Human) Recombinant Protein (Q01)

  • Catalog # : H00387129-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GPR154 partial ORF ( NP_997056, 2 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.46
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00387129-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NPSR1
  • Gene Alias:
  • ASRT2,GPR154,GPRA,NPSR,PGR14,VRR1
  • Gene Description:
  • neuropeptide S receptor 1
  • Gene Summary:
  • This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
  • Other Designations:
  • G protein-coupled receptor 154,G protein-coupled receptor for asthma susceptibility,OTTHUMP00000125228,OTTHUMP00000125229,vasopressin receptor-related receptor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook