Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NPSR1 (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00387129-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NPSR1 full-length ORF (ADR82967.1) recombinant protein without tag.
  • Sequence:
  • MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLFVFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIKSKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRVIRLRQLQEAALMLCPQRENWKGTWPGVPSWALPR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.5
  • Form:
  • Liquid
  • Purification:
  • None
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Gene Name:
  • NPSR1
  • Gene Alias:
  • ASRT2,GPR154,GPRA,NPSR,PGR14,VRR1
  • Gene Description:
  • neuropeptide S receptor 1
  • Gene Summary:
  • This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
  • Other Designations:
  • G protein-coupled receptor 154,G protein-coupled receptor for asthma susceptibility,OTTHUMP00000125228,OTTHUMP00000125229,vasopressin receptor-related receptor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook