Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SUMO4 (Human) Recombinant Protein (P01)

  • Catalog # : H00387082-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SUMO4 full-length ORF ( NP_001002255.1, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00387082-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SUMO4
  • Gene Alias:
  • IDDM5,SMT3H4,SUMO-4,dJ281H8.4
  • Gene Description:
  • SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
  • Gene Summary:
  • This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017390,SMT3 suppressor of mif two 3 homolog 2,SMT3 suppressor of mif two 3 homolog 4,small ubiquitin-like modifier 4 protein,small ubiquitin-like protein 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook