SUMO4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SUMO4 full-length ORF ( NP_001002255.1, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.1
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SUMO4
Entrez GeneID
387082GeneBank Accession#
NM_001002255.1Protein Accession#
NP_001002255.1Gene Name
SUMO4
Gene Alias
IDDM5, SMT3H4, SUMO-4, dJ281H8.4
Gene Description
SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq
Other Designations
OTTHUMP00000017390|SMT3 suppressor of mif two 3 homolog 2|SMT3 suppressor of mif two 3 homolog 4|small ubiquitin-like modifier 4 protein|small ubiquitin-like protein 4
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com