SUMO4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SUMO4 protein.
Immunogen
SUMO4 (NP_001002255.1, 1 a.a. ~ 95 a.a) full-length human protein.
Sequence
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SUMO4 expression in transfected 293T cell line (H00387082-T01) by SUMO4 MaxPab polyclonal antibody.
Lane 1: SUMO4 transfected lysate(10.45 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SUMO4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SUMO4
Entrez GeneID
387082GeneBank Accession#
NM_001002255.1Protein Accession#
NP_001002255.1Gene Name
SUMO4
Gene Alias
IDDM5, SMT3H4, SUMO-4, dJ281H8.4
Gene Description
SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq
Other Designations
OTTHUMP00000017390|SMT3 suppressor of mif two 3 homolog 2|SMT3 suppressor of mif two 3 homolog 4|small ubiquitin-like modifier 4 protein|small ubiquitin-like protein 4
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com