SLC26A5 monoclonal antibody (M04), clone 1F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC26A5 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.78 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC26A5.
Immunogen
SLC26A5 (NP_945350, 645 a.a. ~ 741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALAEQEASAPPSQEDLEPNATPAT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.78 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC26A5 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — SLC26A5
Entrez GeneID
375611GeneBank Accession#
NM_198999Protein Accession#
NP_945350Gene Name
SLC26A5
Gene Alias
DFNB61, MGC118886, MGC118887, MGC118888, MGC118889, PRES
Gene Description
solute carrier family 26, member 5 (prestin)
Omim ID
604943Gene Ontology
HyperlinkGene Summary
This gene is a member of the SLC26A/SulP transporter family. It encodes a protein that is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in this gene have been associated with non-syndromic hearing loss. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
OTTHUMP00000195086|deafness, neurosensory, autosomal recessive, 61|prestin|prestin (motor protein)
-
Disease
-
Publication Reference
-
Prestin autoantibodies screening in idiopathic sudden sensorineural hearing loss.
Tovi H, Ovadia H, Eliashar R, de Jong MA, Gross M.
European Annals of Otorhinolaryngology, Head and Neck Diseases 2019 Apr; 136(2):99.
Application：ELISA, Human, Human serum.
-
Prestin autoantibodies screening in idiopathic sudden sensorineural hearing loss.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com