Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNAJB13 polyclonal antibody (A01)

  • Catalog # : H00374407-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DNAJB13.
  • Immunogen:
  • DNAJB13 (NP_705842, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKIL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00374407-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DNAJB13
  • Gene Alias:
  • FLJ46748,TSARG5,TSARG6
  • Gene Description:
  • DnaJ (Hsp40) related, subfamily B, member 13
  • Gene Summary:
  • DNAJA13 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins. For background information on the DNAJ family, see 608375.[supplied by OMIM
  • Other Designations:
  • 1700014P03Rik,DnaJ-like protein,testis spermatogenesis apoptosis-related protein 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook