Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFS7 (Human) Recombinant Protein (Q01)

  • Catalog # : H00374291-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NDUFS7 partial ORF ( NP_077718, 114 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00374291-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NDUFS7
  • Gene Alias:
  • CI-20KD,FLJ45860,FLJ46880,MGC120002,MY017,PSST
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase)
  • Gene Summary:
  • This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial,NADH-coenzyme Q reductase,NADH-ubiquinone oxidoreductase Fe-S protein 7,NADH:ubiquinone oxidoreductase PSST subunit,complex I, mitochondrial respiratory chain, 20-KD subunit,complex I-20
  • RSS
  • YouTube
  • Linkedin
  • Facebook