NDUFS7 monoclonal antibody (M01), clone 3A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NDUFS7.
Immunogen
NDUFS7 (NP_077718, 114 a.a. ~ 213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — NDUFS7
Entrez GeneID
374291GeneBank Accession#
NM_024407Protein Accession#
NP_077718Gene Name
NDUFS7
Gene Alias
CI-20KD, FLJ45860, FLJ46880, MGC120002, MY017, PSST
Gene Description
NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase)
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions. [provided by RefSeq
Other Designations
NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial|NADH-coenzyme Q reductase|NADH-ubiquinone oxidoreductase Fe-S protein 7|NADH:ubiquinone oxidoreductase PSST subunit|complex I, mitochondrial respiratory chain, 20-KD subunit|complex I-20
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Mitochondrial complex I activity and oxidative damage to mitochondrial proteins in the prefrontal cortex of patients with bipolar disorder.
Ana C Andreazza, Li Shao, Jun-Feng Wang, L Trevor Young.
Archives of General Psychiatry 2010 Apr; 67(4):360.
Application：WB-Ti, Human, Human postmortem prefrontal cortex.
-
Mitochondrial complex I activity and oxidative damage to mitochondrial proteins in the prefrontal cortex of patients with bipolar disorder.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com