LILRA5 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LILRA5 full-length ORF ( NP_067073.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
59.2
Interspecies Antigen Sequence
Mouse (57); Rat (58)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LILRA5
Entrez GeneID
353514GeneBank Accession#
NM_021250.2Protein Accession#
NP_067073.1Gene Name
LILRA5
Gene Alias
CD85, CD85F, ILT11, LILRB7, LIR9
Gene Description
leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5
Omim ID
606047Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000067953|immunoglobulin-like transcript 11 protein|leukocyte Ig-like receptor 9|leukocyte immunoglobulin-like receptor subfamily A member 5|leukocyte immunoglobulin-like receptor subfamily A member 5 soluble|leukocyte immunoglobulin-like recepto
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com