Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LILRA5 (Human) Recombinant Protein (P01)

  • Catalog # : H00353514-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LILRA5 full-length ORF ( NP_067073.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 59.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00353514-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • LILRA5
  • Gene Alias:
  • CD85,CD85F,ILT11,LILRB7,LIR9
  • Gene Description:
  • leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5
  • Gene Summary:
  • The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000067953,immunoglobulin-like transcript 11 protein,leukocyte Ig-like receptor 9,leukocyte immunoglobulin-like receptor subfamily A member 5,leukocyte immunoglobulin-like receptor subfamily A member 5 soluble,leukocyte immunoglobulin-like recepto
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook