NUP43 monoclonal antibody (M03), clone 2G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NUP43 monoclonal antibody (M03), clone 2G5. Western Blot analysis of NUP43 expression in human colon.
Western Blot (Transfected lysate)
Western Blot analysis of NUP43 expression in transfected 293T cell line by NUP43 monoclonal antibody (M03), clone 2G5.
Lane 1: NUP43 transfected lysate(42.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUP43 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NUP43.
Immunogen
NUP43 (NP_078923.3, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NUP43 monoclonal antibody (M03), clone 2G5. Western Blot analysis of NUP43 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of NUP43 expression in transfected 293T cell line by NUP43 monoclonal antibody (M03), clone 2G5.
Lane 1: NUP43 transfected lysate(42.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUP43 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — NUP43
Entrez GeneID
348995GeneBank Accession#
NM_024647Protein Accession#
NP_078923.3Gene Name
NUP43
Gene Alias
FLJ13287, bA350J20.1, p42
Gene Description
nucleoporin 43kDa
Omim ID
608141Gene Ontology
HyperlinkGene Summary
Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM
Other Designations
nucleoporin Nup43
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com