EYS (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EYS partial ORF ( XP_498111, 309 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EYS
Entrez GeneID
346007GeneBank Accession#
XM_498111Protein Accession#
XP_498111Gene Name
EYS
Gene Alias
C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, KIAA0663, RP25, SPAM, bA166P24.2, bA307F22.3, bA74E24.1, dJ1018A4.2, dJ22I17.2, dJ303F19.1
Gene Description
eyes shut homolog (Drosophila)
Gene Ontology
HyperlinkGene Summary
The product of this gene contains multiple epidermal growth factor (EGF)-like and LamG domains. The protein is expressed in the photoreceptor layer of the retina, and the gene is mutated in autosomal recessive retinitis pigmentosa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
EGF-like-domain, multiple 10|EGF-like-domain, multiple 11|Eyes shut homolog|OTTHUMP00000016686|OTTHUMP00000016687|OTTHUMP00000016688|OTTHUMP00000016689|OTTHUMP00000040030|OTTHUMP00000179129|eyes shut homolog|notch-like|retinitis pigmentosa 25 (autosomal r
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com