EYS monoclonal antibody (M02), clone 3F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EYS is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EYS.
Immunogen
EYS (XP_498111, 309 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EYS is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — EYS
Entrez GeneID
346007GeneBank Accession#
XM_498111Protein Accession#
XP_498111Gene Name
EYS
Gene Alias
C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, KIAA0663, RP25, SPAM, bA166P24.2, bA307F22.3, bA74E24.1, dJ1018A4.2, dJ22I17.2, dJ303F19.1
Gene Description
eyes shut homolog (Drosophila)
Gene Ontology
HyperlinkGene Summary
The product of this gene contains multiple epidermal growth factor (EGF)-like and LamG domains. The protein is expressed in the photoreceptor layer of the retina, and the gene is mutated in autosomal recessive retinitis pigmentosa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
EGF-like-domain, multiple 10|EGF-like-domain, multiple 11|Eyes shut homolog|OTTHUMP00000016686|OTTHUMP00000016687|OTTHUMP00000016688|OTTHUMP00000016689|OTTHUMP00000040030|OTTHUMP00000179129|eyes shut homolog|notch-like|retinitis pigmentosa 25 (autosomal r
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com