Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EYS polyclonal antibody (A01)

  • Catalog # : H00346007-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EYS.
  • Immunogen:
  • EYS (XP_498111, 309 a.a. ~ 407 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00346007-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EYS polyclonal antibody (A01), Lot # 051205JC01 Western Blot analysis of EYS expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • EYS
  • Gene Alias:
  • C6orf178,C6orf179,C6orf180,EGFL10,EGFL11,KIAA0663,RP25,SPAM,bA166P24.2,bA307F22.3,bA74E24.1,dJ1018A4.2,dJ22I17.2,dJ303F19.1
  • Gene Description:
  • eyes shut homolog (Drosophila)
  • Gene Summary:
  • The product of this gene contains multiple epidermal growth factor (EGF)-like and LamG domains. The protein is expressed in the photoreceptor layer of the retina, and the gene is mutated in autosomal recessive retinitis pigmentosa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • EGF-like-domain, multiple 10,EGF-like-domain, multiple 11,Eyes shut homolog,OTTHUMP00000016686,OTTHUMP00000016687,OTTHUMP00000016688,OTTHUMP00000016689,OTTHUMP00000040030,OTTHUMP00000179129,eyes shut homolog,notch-like,retinitis pigmentosa 25 (autosomal r
  • RSS
  • YouTube
  • Linkedin
  • Facebook