RAB7B monoclonal antibody (M01), clone 3B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RAB7B monoclonal antibody (M01), clone 3B3. Western Blot analysis of RAB7B expression in human kidney.
Western Blot (Cell lysate)
RAB7B monoclonal antibody (M01), clone 3B3. Western Blot analysis of RAB7B expression in A-431(Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M01), clone 3B3.
Lane 1: RAB7B transfected lysate(22.5 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of RAB7B transfected lysate using anti-RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB7B is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAB7B.
Immunogen
RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RAB7B monoclonal antibody (M01), clone 3B3. Western Blot analysis of RAB7B expression in human kidney.Western Blot (Cell lysate)
RAB7B monoclonal antibody (M01), clone 3B3. Western Blot analysis of RAB7B expression in A-431(Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M01), clone 3B3.
Lane 1: RAB7B transfected lysate(22.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of RAB7B transfected lysate using anti-RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB7B is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RAB7B
-
Publication Reference
-
Rab7b regulates dendritic cell migration by linking lysosomes to the actomyosin cytoskeleton.
Katharina Vestre, Irene Persiconi, Marita Borg Distefano, Nadia Mensali, Noemi Antonella Guadagno, Marine Bretou, Sébastien Wälchli, Catharina Arnold-Schrauf, Oddmund Bakke, Marc Dalod, Ana-Maria Lennon-Dumenil, Cinzia Progida.
Journal of Cell Science 2021 Sep; 134(18):jcs259221.
Application：IF, WB-Tr, Human, Human monocyte-derived dendritic cells.
-
Rab7a regulates cell migration through Rac1 and vimentin.
Margiotta A, Progida C, Bakke O, Bucci C.
Biochimica et Biophysica Acta 2016 Nov; 1864(2):367.
Application：WB-Tr, Human, NCI-H1299 cells.
-
A novel interaction between Rab7b and actomyosin reveals a dual role in intracellular transport and cell migration.
Borg M, Bakke O, Progida C.
Journal of Cell Science 2014 Nov; 127(Pt 22):4927.
Application：IP-WB, WB-Tr, Human, MDDCs, HeLa cells.
-
Clathrin-dependent mechanisms modulate the subcellular distribution of class C Vps/HOPS tether subunits in polarized and nonpolarized cells.
Zlatic SA, Tornieri K, L'hernault SW, Faundez V.
Molecular Biology of the Cell 2011 May; 22(10):1699.
Application：IF, Human, HEK 293T cells.
-
Abnormal localization of leucine-rich repeat kinase 2 to the endosomal-lysosomal compartment in lewy body disease.
Higashi S, Moore DJ, Yamamoto R, Minegishi M, Sato K, Togo T, Katsuse O, Uchikado H, Furukawa Y, Hino H, Kosaka K, Emson PC, Wada K, Dawson VL, Dawson TM, Arai H, Iseki E.
Journal of Neuropathology and Experimental Neurology 2010 Sep; 68(9):994.
Application：IF, IHC-P, Human, Postmortem brains from patients with neurodegenerative disorders.
-
GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation.
Higashi S, Iseki E, Minegishi M, Togo T, Kabuta T, Wada K.
Journal of Neurochemistry 2010 Oct; 115(2):423.
Application：IF, Human, HeLa cells.
-
SPE-39 Family Proteins Interact with the HOPS Complex and Function in Lysosomal Delivery.
Zhu GD, Salazar G, Zlatic SA, Fiza B, Doucette MM, Heilman CJ, Levey AI, Faundez V, L'hernault SW.
Molecular Biology of the Cell 2009 Feb; 20(4):1223.
Application：IF, Human, HEK 293 cells.
-
Rab7b regulates dendritic cell migration by linking lysosomes to the actomyosin cytoskeleton.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com