Product Browser

Last updated: 2017/11/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MMAB (Human) Recombinant Protein (P01)

  • Catalog # : H00326625-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MMAB full-length ORF ( NP_443077.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 53.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00326625-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MMAB
  • Gene Alias:
  • ATR,MGC20496
  • Gene Description:
  • methylmalonic aciduria (cobalamin deficiency) cblB type
  • Gene Summary:
  • This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. [provided by RefSeq
  • Other Designations:
  • ATP:cob(I)alamin adenosyltransferase,ATP:corrinoid adenosyltransferase,aquocob(I)alamin vitamin B12s adenosyltransferase,cob(I)alamin adenosyltransferase,cob(I)yrinic acid a,c-diamide adenosyltransferase,methylmalonic aciduria type B protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook