Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MMAB purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00326625-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MMAB protein.
  • Immunogen:
  • MMAB (NP_443077.1, 1 a.a. ~ 250 a.a) full-length human protein.
  • Sequence:
  • MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MMAB expression in transfected 293T cell line (H00326625-T02) by MMAB MaxPab polyclonal antibody.

    Lane 1: MMAB transfected lysate(27.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MMAB
  • Gene Alias:
  • ATR,MGC20496
  • Gene Description:
  • methylmalonic aciduria (cobalamin deficiency) cblB type
  • Gene Summary:
  • This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. [provided by RefSeq
  • Other Designations:
  • ATP:cob(I)alamin adenosyltransferase,ATP:corrinoid adenosyltransferase,aquocob(I)alamin vitamin B12s adenosyltransferase,cob(I)alamin adenosyltransferase,cob(I)yrinic acid a,c-diamide adenosyltransferase,methylmalonic aciduria type B protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook