PPP1R42 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP1R42 full-length ORF ( NP_001013648.1, 1 a.a. - 228 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRTLHSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLGTYLY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
52.6
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP1R42
Entrez GeneID
286187GeneBank Accession#
NM_001013626.1Protein Accession#
NP_001013648.1Gene Name
PPP1R42
Gene Alias
LRRC67, TLLR, dtr
Gene Description
protein phosphatase 1, regulatory subunit 42
Gene Ontology
HyperlinkGene Summary
leucine rich repeat containing 67; leucine-rich repeat-containing protein 67; protein phosphatase 1 regulatory subunit 42; testis leucine-rich repeat
Other Designations
leucine rich repeat containing 67; leucine-rich repeat-containing protein 67; protein phosphatase 1 regulatory subunit 42; testis leucine-rich repeat
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com