NSMCE2 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NSMCE2 expression in transfected 293T cell line (H00286053-T01) by NSMCE2 MaxPab polyclonal antibody.
Lane 1: C8orf36 transfected lysate(27.17 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NSMCE2 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NSMCE2 protein.
Immunogen
NSMCE2 (NP_775956.1, 1 a.a. ~ 247 a.a) full-length human protein.
Sequence
MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NSMCE2 expression in transfected 293T cell line (H00286053-T01) by NSMCE2 MaxPab polyclonal antibody.
Lane 1: C8orf36 transfected lysate(27.17 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NSMCE2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NSMCE2
Entrez GeneID
286053GeneBank Accession#
NM_173685Protein Accession#
NP_775956.1Gene Name
NSMCE2
Gene Alias
C8orf36, FLJ32440, MMS21, NSE2
Gene Description
non-SMC element 2, MMS21 homolog (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
O
Other Designations
methyl methanesulfonate sensitivity gene 21|non-SMC element 2, MMS21 homolog
-
Interactome
-
Disease
-
Publication Reference
-
Expulsion of micronuclei containing amplified genes contributes to a decrease in double minute chromosomes from malignant tumor cells.
Ji W, Bian Z, Yu Y, Yuan C, Liu Y, Yu L, Li C, Zhu J, Jia X, Guan R, Zhang C, Meng X, Jin Y, Bai J, Yu J, Lee KY, Sun W, Fu S.
International Journal of Cancer 2014 Mar; 134(6):1279.
Application：WB, Human, NCI-H716 cells.
-
De novo assembly of a PML nuclear subcompartment occurs through multiple pathways and induces telomere elongation.
Chung I, Leonhardt H, Rippe K.
Journal of Cell Science 2011 Nov; 124(Pt 21):3603.
Application：IF, Human, U2OS cells.
-
Expulsion of micronuclei containing amplified genes contributes to a decrease in double minute chromosomes from malignant tumor cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com