C5orf51 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
C5orf51 MaxPab polyclonal antibody. Western Blot analysis of C5orf51 expression in HepG2 .
Western Blot (Transfected lysate)
Western Blot analysis of C5orf51 expression in transfected 293T cell line (H00285636-T01) by C5orf51 MaxPab polyclonal antibody.
Lane 1: C5orf51 transfected lysate(32.34 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C5orf51 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C5orf51 protein.
Immunogen
C5orf51 (NP_787117.3, 1 a.a. ~ 294 a.a) full-length human protein.
Sequence
MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
C5orf51 MaxPab polyclonal antibody. Western Blot analysis of C5orf51 expression in HepG2 .Western Blot (Transfected lysate)
Western Blot analysis of C5orf51 expression in transfected 293T cell line (H00285636-T01) by C5orf51 MaxPab polyclonal antibody.
Lane 1: C5orf51 transfected lysate(32.34 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C5orf51 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — C5orf51
Entrez GeneID
285636GeneBank Accession#
NM_175921Protein Accession#
NP_787117.3Gene Name
C5orf51
Gene Alias
-
Gene Description
chromosome 5 open reading frame 51
Gene Ontology
HyperlinkOther Designations
UPF0600 protein|hypothetical protein LOC285636
-
Interactome
-
Publication Reference
-
C5orf51 is a component of the MON1-CCZ1 complex and controls RAB7A localization and stability during mitophagy.
Bing-Ru Yan, Taoyingnan Li, Etienne Coyaud, Estelle M N Laurent, Jonathan St-Germain, Yuhuan Zhou, Peter K Kim, Brian Raught, John H Brumell.
Autophagy 2021 Aug; 1.
Application：WB-Tr, Human, HEK 293T cells.
-
C5orf51 is a component of the MON1-CCZ1 complex and controls RAB7A localization and stability during mitophagy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com