CYP4V2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CYP4V2 MaxPab rabbit polyclonal antibody. Western Blot analysis of CYP4V2 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of CYP4V2 expression in transfected 293T cell line (H00285440-T02) by CYP4V2 MaxPab polyclonal antibody.
Lane 1: CYP4V2 transfected lysate(60.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CYP4V2 protein.
Immunogen
CYP4V2 (NP_997235.2, 1 a.a. ~ 525 a.a) full-length human protein.
Sequence
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CYP4V2 MaxPab rabbit polyclonal antibody. Western Blot analysis of CYP4V2 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of CYP4V2 expression in transfected 293T cell line (H00285440-T02) by CYP4V2 MaxPab polyclonal antibody.
Lane 1: CYP4V2 transfected lysate(60.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CYP4V2
Entrez GeneID
285440GeneBank Accession#
NM_207352.2Protein Accession#
NP_997235.2Gene Name
CYP4V2
Gene Alias
BCD, CYP4AH1, FLJ18432, MGC43534
Gene Description
cytochrome P450, family 4, subfamily V, polypeptide 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. [provided by RefSeq
Other Designations
cytochrome P450 4V2|cytochrome P450, family 4, subfamily v, polypeptide 2|retina CYP4V2
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com