FBXW12 monoclonal antibody (M03), clone 1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FBXW12 monoclonal antibody (M03), clone 1A9. Western Blot analysis of FBXW12 expression in HepG2.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FBXW12 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBXW12.
Immunogen
FBXW12 (NP_996985.1, 265 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FBXW12 monoclonal antibody (M03), clone 1A9. Western Blot analysis of FBXW12 expression in HepG2.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FBXW12 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — FBXW12
Entrez GeneID
285231GeneBank Accession#
NM_207102Protein Accession#
NP_996985.1Gene Name
FBXW12
Gene Alias
FBXO12, FBXO35, Fbw12, MGC120385, MGC120386, MGC120387
Gene Description
F-box and WD repeat domain containing 12
Omim ID
609075Gene Ontology
HyperlinkGene Summary
Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM
Other Designations
F-box and WD-40 domain protein 12|F-box only protein 35|F-box- and WD40-repeat-containing protein|OTTHUMP00000164809
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com