Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPHA6 monoclonal antibody (M01), clone 2H2

  • Catalog # : H00285220-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant EPHA6.
  • Immunogen:
  • EPHA6 (XP_114973, 613 a.a. ~ 712 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDGKFHCCSLKTDP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of EPHA6 expression in transfected 293T cell line by EPHA6 monoclonal antibody (M01), clone 2H2.

    Lane 1: EPHA6 transfected lysate(113.96 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged EPHA6 is approximately 3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • EPHA6
  • Gene Alias:
  • DKFZp434C1418,EPA6,FLJ35246,PRO57066
  • Gene Description:
  • EPH receptor A6
  • Other Designations:
  • ephrin receptor EphA6
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook