BLOC1S2 monoclonal antibody (M01), clone 8C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BLOC1S2 expression in transfected 293T cell line by BLOC1S2 monoclonal antibody (M01), clone 8C10.
Lane 1: BLOC1S2 transfected lysate (Predicted MW: 16 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BLOC1S2 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (42.4 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant BLOC1S2.
Immunogen
BLOC1S2 (NP_776170.2, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BLOC1S2 expression in transfected 293T cell line by BLOC1S2 monoclonal antibody (M01), clone 8C10.
Lane 1: BLOC1S2 transfected lysate (Predicted MW: 16 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BLOC1S2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — BLOC1S2
Entrez GeneID
282991GeneBank Accession#
NM_173809.2Protein Accession#
NP_776170.2Gene Name
BLOC1S2
Gene Alias
BLOS2, FLJ30135, MGC10120, RP11-316M21.4
Gene Description
biogenesis of lysosomal organelles complex-1, subunit 2
Gene Ontology
HyperlinkGene Summary
BLOC1S2 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM
Other Designations
biogenesis of lysosome-related organelles complex-1, subunit 2|centrosomal 10 kDa protein|centrosome protein oncogene
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com