Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STEAP2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00261729-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human STEAP2 partial ORF ( NP_694544.1, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ESISMMGSPKSLSETVLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00261729-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • STEAP2
  • Gene Alias:
  • IPCA1,PCANAP1,PUMPCn,STAMP1,STMP
  • Gene Description:
  • six transmembrane epithelial antigen of the prostate 2
  • Gene Summary:
  • This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase and cupric reductase activity, and stimulates the cellular uptake of both iron and copper in vitro. Increased transcriptional expression of the human gene is associated with prostate cancer progression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000067572,OTTHUMP00000067575,SixTransMembrane Protein of Prostate 1,prostate cancer associated protein 1,protein upregulated in metastatic prostate cancer,six transmembrane epithelial antigen of prostate 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook