Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIPRL (Human) Recombinant Protein (P01)

  • Catalog # : H00261726-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TIPRL full-length ORF ( NP_001026970.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSSLSVKIPGGGHL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 46.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00261726-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TIPRL
  • Gene Alias:
  • MGC3794,TIP,TIP41,dJ69E11.3
  • Gene Description:
  • TIP41, TOR signaling pathway regulator-like (S. cerevisiae)
  • Gene Summary:
  • TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A) (see PPP2CA; MIM 176915), PP4 (see PPP4C; MIM 602035), and PP6 (see PPP6C; MIM 300141) (McConnell et al., 2007 [PubMed 17384681]).[supplied by OMIM
  • Other Designations:
  • CG9578-like,OTTHUMP00000032581,OTTHUMP00000032582,TIP41, TOR signalling pathway regulator-like,putative MAPK activating protein,yeast YPR037W and worm C02C2.6 predicted proteins-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook