Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FDCSP (Human) Recombinant Protein (P01)

  • Catalog # : H00260436-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FDCSP full-length ORF (AAH62213.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.75
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • FDCSP
  • Gene Alias:
  • UNQ733/PRO1419,C4orf7,FDC-SP
  • Gene Description:
  • follicular dendritic cell secreted protein
  • Gene Summary:
  • FDCSP is expressed by follicular dendritic cells (FDCs) and activated leukocytes during ongoing immune responses.[supplied by OMIM
  • Other Designations:
  • FDC secreted protein; follicular dendritic cell secreted peptide
  • RSS
  • YouTube
  • Linkedin
  • Facebook