Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TMIE (Human) Recombinant Protein (Q01)

  • Catalog # : H00259236-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TMIE partial ORF ( NP_671729, 79 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.56
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00259236-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TMIE
  • Gene Alias:
  • DFNB6
  • Gene Description:
  • transmembrane inner ear
  • Gene Summary:
  • This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. [provided by RefSeq
  • Other Designations:
  • transmembrane inner ear protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook