TAB3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAB3 partial ORF ( NP_690000, 58 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
YHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPFFMNEQNRSA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.86
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MAP3K7IP3
Entrez GeneID
257397GeneBank Accession#
NM_152787Protein Accession#
NP_690000Gene Name
MAP3K7IP3
Gene Alias
MGC45404, NAP1, TAB3
Gene Description
mitogen-activated protein kinase kinase kinase 7 interacting protein 3
Omim ID
300480Gene Ontology
HyperlinkGene Summary
The product of this gene functions in the NF-kappaB signal transduction pathway. The encoded protein, and the similar and functionally redundant protein MAP3K7IP2/TAB2, forms a ternary complex with the protein kinase MAP3K7/TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent MAP3K7/TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
Mitogen-activated protein kinase kinase kinase 7-interacting protein 3|NF-kappa-B-activating protein 1|NFkB activating protein 1|OTTHUMP00000023112|TAK1 binding protein 3|TAK1-binding protein 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com