Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UTS2D purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00257313-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human UTS2D protein.
  • Immunogen:
  • UTS2D (NP_937795.1, 1 a.a. ~ 119 a.a) full-length human protein.
  • Sequence:
  • MNKILSSTVCFGLLTLLSVLIFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of UTS2D expression in transfected 293T cell line (H00257313-T01) by UTS2D MaxPab polyclonal antibody.

    Lane 1: UTS2D transfected lysate(13.09 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • UTS2D
  • Gene Alias:
  • MGC138371,U2B,URP
  • Gene Description:
  • urotensin 2 domain containing
  • Other Designations:
  • urotensin II-related peptide,urotensin IIB
  • RSS
  • YouTube
  • Linkedin
  • Facebook