PTF1A monoclonal antibody (M01), clone 4B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PTF1A.
Immunogen
PTF1A (NP_835455, 250 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTF1A is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — PTF1A
Entrez GeneID
256297GeneBank Accession#
NM_178161Protein Accession#
NP_835455Gene Name
PTF1A
Gene Alias
PTF1-p48, bHLHa29
Gene Description
pancreas specific transcription factor, 1a
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq
Other Designations
OTTHUMP00000019309|bHLH transcription factor p48|class II bHLH protein PTF1A|exocrine pancreas-specific transcription factor p48|p48 DNA-binding subunit of transcription factor PTF1|pancreas transcription factor 1 subunit alpha
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com