Product Browser

Last updated: 2017/1/22
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BCL6B polyclonal antibody (A01)

  • Catalog # : H00255877-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BCL6B.
  • Immunogen:
  • BCL6B (NP_862827, 248 a.a. ~ 345 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00255877-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • BCL6B
  • Gene Alias:
  • BAZF,ZBTB28,ZNF62
  • Gene Description:
  • B-cell CLL/lymphoma 6, member B (zinc finger protein)
  • Other Designations:
  • zinc finger protein 62
  • RSS
  • YouTube
  • Linkedin
  • Facebook