Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HIST1H2BA (Human) Recombinant Protein (P01)

  • Catalog # : H00255626-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HIST1H2BA full-length ORF (BAG34991.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.37
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • HIST1H2BA
  • Gene Alias:
  • H2BFU,STBP,TSH2B,bA317E16.3
  • Gene Description:
  • histone cluster 1, H2ba
  • Gene Summary:
  • Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq
  • Other Designations:
  • H2B histone family, member U, (testis-specific),histone 1, H2ba,testis-specific histone H2B
  • RSS
  • YouTube
  • Linkedin
  • Facebook