LASS6 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant LASS6.
Immunogen
LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Sequence
PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.81 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — LASS6
Entrez GeneID
253782GeneBank Accession#
NM_203463Protein Accession#
NP_982288Gene Name
LASS6
Gene Alias
CerS6, MGC129949, MGC129950
Gene Description
LAG1 homolog, ceramide synthase 6
Gene Ontology
HyperlinkGene Summary
O
Other Designations
LAG1 longevity assurance homolog 6|longevity assurance homolog 6
-
Interactome
-
Disease
-
Publication Reference
-
High levels of modified ceramides are a defining feature of murine and human cancer cachexia.
Pauline Morigny, Julia Zuber, Mark Haid, Doris Kaltenecker, Fabien Riols, Joanna D C Lima, Estefania Simoes, José Pinhata Otoch, Sören Fisker Schmidt, Stephan Herzig, Jerzy Adamski, Marilia Seelaender, Mauricio Berriel Diaz, Maria Rohm.
Journal of Cachexia, Sarcopenia and Muscle 2020 Dec; 11(6):1459.
Application:WB-Ti, Mouse, Mouse liver.
-
Cytochrome c oxidase deficiency accelerates mitochondrial apoptosis by activating ceramide synthase 6.
Schull S, Gunther SD, Brodesser S, Seeger JM, Tosetti B, Wiegmann K, Pongratz C, Diaz F, Witt A, Andree M, Brinkmann K, Kronke M, Wiesner RJ, Kashkar H.
Cell Death & Disease 2015 Mar; 6:e1691.
Application:WB, WB-Tr, Human, Mouse, HeLa, HeLa-mock, HeLa-SiScr, HeLa-SiCerS6, 143B, 143BΔCOX, 143B-mock, 143B-SiScr, 143B-SiCerS6,COC10-/- COX10FL/FL-SiScr, COX10FL/FL-SiCerS6 cells.
-
Radiation-induced acid ceramidase confers prostate cancer resistance and tumor relapse.
Cheng JC, Bai A, Beckham TH, Marrison ST, Yount CL, Young K, Lu P, Bartlett AM, Wu BX, Keane BJ, Armeson KE, Marshall DT, Keane TE, Smith MT, Jones EE, Drake RR Jr, Bielawska A, Norris JS, Liu X.
Journal of Clinical Investigation 2013 Oct; 123(10):4344.
Application:WB, Human, PPC-1.
-
siRNA-mediated down-regulation of ceramide synthase 1 leads to apoptotic resistance in human head and neck squamous carcinoma cells after photodynamic therapy.
Separovic D, Breen P, Joseph N, Bielawski J, Pierce JS, VAN Buren E, Gudz TI.
Anticancer research 2012 Jul; 32(7):2479.
Application:WB-Tr, Human, UM-SCC-22A cells.
-
Ceramide synthase 6 knockdown suppresses apoptosis after photodynamic therapy in human head and neck squamous carcinoma cells.
Separovic D, Breen P, Joseph N, Bielawski J, Pierce JS, VAN Buren E, Gudz TI.
Anticancer Research 2012 Mar; 32(3):753.
Application:WB-Ce, Human, Treated UM-SCC-22A.
-
Alteration of Ceramide Synthase 6/C16-Ceramide Induces Activating Transcription Factor 6-mediated Endoplasmic Reticulum (ER) Stress and Apoptosis via Perturbation of Cellular Ca2+ and ER/Golgi Membrane Network.
Senkal CE, Ponnusamy S, Manevich Y, Meyers-Needham M, Saddoughi SA, Mukhopadyay A, Dent P, Bielawski J, Ogretmen B.
The Journal of Biological Chemistry 2011 Dec; 286(49):42446.
Application:WB-Ce, Human, UM-SCC-22A cells.
-
Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.
Senkal CE, Ponnusamy S, Bielawski J, Hannun YA, Ogretmen B.
FASEB Journal 2010 Jan; 24(1):296.
Application:WB, Human, HNSCC cells.
-
Ceramide synthase 6 modulates TRAIL sensitivity and nuclear translocation of active caspase-3 in colon cancer cells.
White-Gilbertson S, Mullen T, Senkal C, Lu P, Ogretmen B, Obeid L, Voelkel-Johnson C.
Oncogene 2009 Jan; 28(8):1132.
Application:WB-Ce, WB-Tr, Human, SW480, SW-620 cells.
-
JNK3 signaling pathway activates ceramide synthase leading to mitochondrial dysfunction.
Yu J, Novgorodov SA, Chudakova D, Zhu H, Bielawska A, Bielawski J, Obeid LM, Kindy MS, Gudz TI.
The Journal of Biological Chemistry 2007 Jul; 282(35):25940.
Application:WB, Mouse, Mouse brain.
-
Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas.
Senkal CE, Ponnusamy S, Rossi MJ, Bialewski J, Sinha D, Jiang JC, Jazwinski SM, Hannun YA, Ogretmen B.
Molecular Cancer Therapeutics 2007 Feb; 6(2):712.
Application:WB, Human, Human head and neck squamous cell carcinomas, UM-SCC-22A cells.
-
High levels of modified ceramides are a defining feature of murine and human cancer cachexia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com