FNDC5 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FNDC5 full-length ORF ( NP_715637.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41.9
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FNDC5
Entrez GeneID
252995GeneBank Accession#
NM_153756.1Protein Accession#
NP_715637.1Gene Name
FNDC5
Gene Alias
FRCP2
Gene Description
fibronectin type III domain containing 5
Gene Ontology
HyperlinkOther Designations
OTTHUMP00000004134
-
Interactome
-
Publication Reference
-
Irisin improves fatty acid oxidation and glucose utilization in type 2 diabetes by regulating the AMPK signaling pathway.
Xin C, Liu J, Zhang J, Zhu D, Wang H, Xiong L, Lee Y, Ye J, Lian K, Xu C, Zhang L, Wang Q, Liu Y, Tao L.
International Journal of Obesity (2005) 2016 Mar; 40(3):443.
Application:Func, Mouse, Mouse heart, skeletal muscle.
-
Browning of white fat: does irisin play a role in humans?
Elsen M, Raschke S, Eckel J.
The Journal of Endocrinology 2014 Jul; 222(1):R25.
-
Irisin and FNDC5 in retrospect: An exercise hormone or a transmembrane receptor?
Erickson HP.
Adipocyte 2013 Oct; 2(4):289.
-
Beige adipocytes are a distinct type of thermogenic fat cell in mouse and human.
Jun Wu, Pontus Boström, Lauren M Sparks, Li Ye, Jang Hyun Choi, An-Hoa Giang, Melin Khandekar, Kirsi A Virtanen, Pirjo Nuutila, Gert Schaart, Kexin Huang, Hua Tu, Wouter D van Marken Lichtenbelt, Joris Hoeks, Sven Enerbäck, Patrick Schrauwen, Bruce M Spiegelman.
Cell 2012 Jul; 150(2):366.
Application:Sub, Mouse, Mouse primary stromal vascular.
-
A PGC1-α-dependent myokine that drives brown-fat-like development of white fat and thermogenesis.
Boström P, Wu J, Jedrychowski MP, Korde A, Ye L, Lo JC, Rasbach KA, Boström EA, Choi JH, Long JZ, Kajimura S, Zingaretti MC, Vind BF, Tu H, Cinti S, Højlund K, Gygi SP, Spiegelman BM.
Nature 2012 Jan; 481(7382):463.
Application:WB-Re, Treatment, Human, Mouse, Serum, SVF cells.
-
Irisin improves fatty acid oxidation and glucose utilization in type 2 diabetes by regulating the AMPK signaling pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com