IL27 monoclonal antibody (M01), clone 3F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IL27.
Immunogen
IL27 (NP_663634, 177 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IL27 monoclonal antibody (M01), clone 3F12 Western Blot analysis of IL27 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of IL27 expression in transfected 293T cell line by IL27 monoclonal antibody (M01), clone 3F12.
Lane 1: IL27 transfected lysate(27.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of IL27 transfected lysate using anti-IL27 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL27 MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — IL27
Entrez GeneID
246778GeneBank Accession#
NM_145659Protein Accession#
NP_663634Gene Name
IL27
Gene Alias
IL-27, IL-27A, IL27p28, IL30, MGC71873, p28
Gene Description
interleukin 27
Omim ID
608273Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR). [provided by RefSeq
Other Designations
IL-27 p28 subunit|OTTHUMP00000122516|interleukin 30|interleukin-27 subunit alpha
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com