RNASEH1 monoclonal antibody (M01), clone 5D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNASEH1.
Immunogen
RNASEH1 (NP_002927, 189 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (77); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RNASEH1 monoclonal antibody (M01), clone 5D10 Western Blot analysis of RNASEH1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
RNASEH1 monoclonal antibody (M01), clone 5D10. Western Blot analysis of RNASEH1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RNASEH1 expression in transfected 293T cell line by RNASEH1 monoclonal antibody (M01), clone 5D10.
Lane 1: RNASEH1 transfected lysate(32.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNASEH1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RNASEH1
-
Interactome
-
Pathway
-
Publication Reference
-
The FANCI/FANCD2 complex links DNA damage response to R-loop regulation through SRSF1-mediated mRNA export.
Anne Olazabal-Herrero, Boxue He, Youngho Kwon, Abhishek K Gupta, Arijit Dutta, Yuxin Huang, Prajwal Boddu, Zhuobin Liang, Fengshan Liang, Yaqun Teng, Li Lan, Xiaoyong Chen, Huadong Pei, Manoj M Pillai, Patrick Sung, Gary M Kupfer.
Cell Reports 2024 Jan; 43(1):113610.
Application:WB, Human, HeLa cells.
-
The FANCI/FANCD2 complex links DNA damage response to R-loop regulation through SRSF1-mediated mRNA export.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com