Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP6V1C2 polyclonal antibody (A01)

  • Catalog # : H00245973-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ATP6V1C2.
  • Immunogen:
  • ATP6V1C2 (NP_653184, 188 a.a. ~ 253 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00245973-A01
    Western Blot detection against Immunogen (33.37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ATP6V1C2
  • Gene Alias:
  • ATP6C2,VMA5
  • Gene Description:
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
  • Gene Summary:
  • This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A,three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms. [provided by RefSeq
  • Other Designations:
  • ATPase, H+ transporting, lysosomal 42kD, V1 subunit C,OTTHUMP00000115522,V-ATPase C2 subunit,vacuolar H+ ATPase C2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook