Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP6V0D2 monoclonal antibody (M01A), clone 7A4

  • Catalog # : H00245972-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ATP6V0D2.
  • Immunogen:
  • ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00245972-M01A
    Western Blot detection against Immunogen (33.33 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ATP6V0D2
  • Gene Alias:
  • ATP6D2,FLJ38708,VMA6
  • Gene Description:
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
  • Other Designations:
  • ATPase, H+ transporting, lysosomal 38kD, V0 subunit d,ATPase, H+ transporting, lysosomal 38kDa, V0 subunit D2
  • RSS
  • YouTube
  • Linkedin
  • Facebook