SPDYA (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SPDYA full-length ORF ( NP_877433.2, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
62.9
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SPDYA
Entrez GeneID
245711GeneBank Accession#
NM_182756.2Protein Accession#
NP_877433.2Gene Name
SPDYA
Gene Alias
MGC110856, MGC57218, Ringo3, SPDY1, SPY1
Gene Description
speedy homolog A (Xenopus laevis)
Gene Ontology
HyperlinkOther Designations
OTTHUMP00000082662|OTTHUMP00000082663|OTTHUMP00000082664|speedy A|speedy homolog A
-
Publication Reference
-
Differential Immunogenicity and Clinical Relevance of Kidney Compartment Specific Antigens after Renal Transplantation.
Li L, Sigdel TK, Vitalone M, Lee SH, Sarwal MM.
Journal of Proteome Research 2010 Dec; 9(12):6715.
Application：ELISA, As a standard.
-
Differential Immunogenicity and Clinical Relevance of Kidney Compartment Specific Antigens after Renal Transplantation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com