SLC29A4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SLC29A4 partial ORF ( NP_694979, 283 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.67
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SLC29A4
Entrez GeneID
222962GeneBank Accession#
NM_153247Protein Accession#
NP_694979Gene Name
SLC29A4
Gene Alias
ENT4, FLJ34923, PMAT
Gene Description
solute carrier family 29 (nucleoside transporters), member 4
Omim ID
609149Gene Ontology
HyperlinkGene Summary
This gene is a member of the SLC29 family and encodes a plasma membrane protein with 11 transmembrane helices. This protein catalyzes the reuptake of monoamines into presynaptic neurons, thus determining the intensity and duration of monoamine neural signaling. It has been shown to transport several compounds, including serotonin, dopamine, and the neurotoxin 1-methyl-4-phenylpyridinium. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq
Other Designations
OTTHUMP00000025415|equilibrative nucleoside transporter 4|plasma membrane monoamine transporter
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com