Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCUBE3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00222663-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SCUBE3 partial ORF ( NP_689966, 401 a.a. - 499 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LKCQGSPGASKAMLSCNRSGKKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIKQRASFKIKDAKCRLHLRNK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00222663-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SCUBE3
  • Gene Alias:
  • CEGF3,DKFZp686B09105,DKFZp686B1223,DKFZp686D20108,FLJ34743
  • Gene Description:
  • signal peptide, CUB domain, EGF-like 3
  • Other Designations:
  • CUB and EGF containing protein 3,CUB domain and EGF-like repeat containing 3,OTTHUMP00000016250,signal peptide, CUB and EGF-like domain containing protein 3
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook