Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCUBE3 monoclonal antibody (M07), clone 1D6

  • Catalog # : H00222663-M07
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SCUBE3.
  • Immunogen:
  • SCUBE3 (AAH52263.2, 29 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00222663-M07
    Western Blot detection against Immunogen (38.83 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SCUBE3 is 0.1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • SCUBE3
  • Gene Alias:
  • CEGF3,DKFZp686B09105,DKFZp686B1223,DKFZp686D20108,FLJ34743
  • Gene Description:
  • signal peptide, CUB domain, EGF-like 3
  • Other Designations:
  • CUB and EGF containing protein 3,CUB domain and EGF-like repeat containing 3,OTTHUMP00000016250,signal peptide, CUB and EGF-like domain containing protein 3
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook