Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCUBE3 polyclonal antibody (A01)

  • Catalog # : H00222663-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SCUBE3.
  • Immunogen:
  • SCUBE3 (NP_689966, 401 a.a. ~ 499 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LKCQGSPGASKAMLSCNRSGKKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIKQRASFKIKDAKCRLHLRNK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00222663-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SCUBE3
  • Gene Alias:
  • CEGF3,DKFZp686B09105,DKFZp686B1223,DKFZp686D20108,FLJ34743
  • Gene Description:
  • signal peptide, CUB domain, EGF-like 3
  • Other Designations:
  • CUB and EGF containing protein 3,CUB domain and EGF-like repeat containing 3,OTTHUMP00000016250,signal peptide, CUB and EGF-like domain containing protein 3
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook