Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

JAZF1 polyclonal antibody (A01)

  • Catalog # : H00221895-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant JAZF1.
  • Immunogen:
  • JAZF1 (NP_778231, 165 a.a. ~ 243 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00221895-A01
    Western Blot detection against Immunogen (34.8 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • JAZF1 polyclonal antibody (A01), Lot # 060509JCS1. Western Blot analysis of JAZF1 expression in Daoy.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • JAZF1
  • Gene Alias:
  • DKFZp761K2222,TIP27,ZNF802
  • Gene Description:
  • JAZF zinc finger 1
  • Gene Summary:
  • This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized [provided by RefSeq
  • Other Designations:
  • TAK1-interacting protein 27,juxtaposed with another zinc finger gene 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook