PRPS1L1 monoclonal antibody (M01), clone 5E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
PRPS1L1 monoclonal antibody (M01), clone 5E10 Western Blot analysis of PRPS1L1 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRPS1L1.
Immunogen
PRPS1L1 (NP_787082, 146 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATR
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
PRPS1L1 monoclonal antibody (M01), clone 5E10 Western Blot analysis of PRPS1L1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PRPS1L1
Entrez GeneID
221823GeneBank Accession#
NM_175886Protein Accession#
NP_787082Gene Name
PRPS1L1
Gene Alias
PRPS1, PRPS3, PRPSL, PRS-III
Gene Description
phosphoribosyl pyrophosphate synthetase 1-like 1
Omim ID
611566Gene Ontology
HyperlinkGene Summary
This intronless gene is specifically expressed in the testis, and encodes a protein that is highly homologous to the two subunits of phosphoribosylpyrophosphate synthetase encoded by human X-linked genes, PRPS1 and PRPS2. These enzymes convert pyrimidine, purine or pyridine bases to the corresponding ribonucleoside monophosphates. In vitro transcription/translation and site-directed mutagenesis studies indicate that translation of this mRNA initiates exclusively at a non-AUG (ACG) codon. [provided by RefSeq
Other Designations
phosphoribosylpyrophosphate synthetase subunit III|ribose-phosphate diphosphokinase catalytic chain III|ribose-phosphate pyrophosphokinase III
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com