Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRPS1L1 monoclonal antibody (M01), clone 5E10

  • Catalog # : H00221823-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PRPS1L1.
  • Immunogen:
  • PRPS1L1 (NP_787082, 146 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • YAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATR
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG3 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00221823-M01
    Western Blot detection against Immunogen (36.52 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PRPS1L1 monoclonal antibody (M01), clone 5E10 Western Blot analysis of PRPS1L1 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in Raw 264.7 ( Cat # L024V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PRPS1L1 monoclonal antibody (M01), clone 5E10. Western Blot analysis of PRPS1L1 expression in NIH/3T3 ( Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PRPS1L1
  • Gene Alias:
  • PRPS1,PRPS3,PRPSL,PRS-III
  • Gene Description:
  • phosphoribosyl pyrophosphate synthetase 1-like 1
  • Gene Summary:
  • This intronless gene is specifically expressed in the testis, and encodes a protein that is highly homologous to the two subunits of phosphoribosylpyrophosphate synthetase encoded by human X-linked genes, PRPS1 and PRPS2. These enzymes convert pyrimidine, purine or pyridine bases to the corresponding ribonucleoside monophosphates. In vitro transcription/translation and site-directed mutagenesis studies indicate that translation of this mRNA initiates exclusively at a non-AUG (ACG) codon. [provided by RefSeq
  • Other Designations:
  • phosphoribosylpyrophosphate synthetase subunit III,ribose-phosphate diphosphokinase catalytic chain III,ribose-phosphate pyrophosphokinase III
  • RSS
  • YouTube
  • Linkedin
  • Facebook