Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C6orf206 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00221421-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human C6orf206 protein.
  • Immunogen:
  • C6orf206 (NP_689945, 1 a.a. ~ 276 a.a) full-length human protein.
  • Sequence:
  • MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of C6orf206 expression in transfected 293T cell line (H00221421-T01) by C6orf206 MaxPab polyclonal antibody.

    Lane 1: C6orf206 transfected lysate(30.36 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • C6orf206
  • Gene Alias:
  • FLJ30845,MRPS18AL1
  • Gene Description:
  • chromosome 6 open reading frame 206
  • Gene Summary:
  • Radial spokes are regularly spaced along cilia, sperm, and flagella axonemes and have a multisubunit 'stalk' and 'head' that form a signal transduction scaffold between the central microtubule pair and dynein (see MIM 603297) arms. RSPH9 is predicted to be a component of the radial spoke head based on homology with proteins in the biflagellate alga Chlamydomonas reinhardtii and other ciliates (Castleman et al., 2009 [PubMed 19200523]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000016494,hypothetical protein LOC221421,mitochondrial ribosomal protein S18A-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook