C6orf206 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C6orf206 protein.
Immunogen
C6orf206 (NP_689945, 1 a.a. ~ 276 a.a) full-length human protein.
Sequence
MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C6orf206 expression in transfected 293T cell line (H00221421-T01) by C6orf206 MaxPab polyclonal antibody.
Lane 1: C6orf206 transfected lysate(30.36 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C6orf206 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — C6orf206
Entrez GeneID
221421GeneBank Accession#
NM_152732Protein Accession#
NP_689945Gene Name
C6orf206
Gene Alias
FLJ30845, MRPS18AL1
Gene Description
chromosome 6 open reading frame 206
Gene Ontology
HyperlinkGene Summary
Radial spokes are regularly spaced along cilia, sperm, and flagella axonemes and have a multisubunit 'stalk' and 'head' that form a signal transduction scaffold between the central microtubule pair and dynein (see MIM 603297) arms. RSPH9 is predicted to be a component of the radial spoke head based on homology with proteins in the biflagellate alga Chlamydomonas reinhardtii and other ciliates (Castleman et al., 2009 [PubMed 19200523]).[supplied by OMIM
Other Designations
OTTHUMP00000016494|hypothetical protein LOC221421|mitochondrial ribosomal protein S18A-like 1
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com