DEPC-1 monoclonal antibody (M01), clone 2A5-4F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DEPC-1 monoclonal antibody (M01), clone 2A5-4F5 Western Blot analysis of DEPC-1 expression in K-562 ( Cat # L009V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DEPC-1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (41.03 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant DEPC-1.
Immunogen
DEPC-1 (AAH15155, 1 a.a. ~ 139 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.03 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DEPC-1 monoclonal antibody (M01), clone 2A5-4F5 Western Blot analysis of DEPC-1 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DEPC-1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ALKBH3
Entrez GeneID
221120GeneBank Accession#
BC015155Protein Accession#
AAH15155Gene Name
ALKBH3
Gene Alias
ABH3, DEPC-1, DEPC1, MGC118790, MGC118792, MGC118793, PCA1
Gene Description
alkB, alkylation repair homolog 3 (E. coli)
Omim ID
610603Gene Ontology
HyperlinkGene Summary
The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM
Other Designations
alkB, alkylation repair homolog 3|prostate cancer antigen-1
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com