ATOH7 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ATOH7 protein.
Immunogen
ATOH7 (NP_660161.1, 1 a.a. ~ 152 a.a) full-length human protein.
Sequence
MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ATOH7 expression in transfected 293T cell line (H00220202-T02) by ATOH7 MaxPab polyclonal antibody.
Lane 1: ATOH7 transfected lysate(16.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATOH7
Entrez GeneID
220202GeneBank Accession#
NM_145178.2Protein Accession#
NP_660161.1Gene Name
ATOH7
Gene Alias
Math5, bHLHa13
Gene Description
atonal homolog 7 (Drosophila)
Omim ID
609875Gene Ontology
HyperlinkGene Summary
ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM
Other Designations
OTTHUMP00000019697|atonal homolog 7
-
Disease
-
Publication Reference
-
ATOH7 mutations cause autosomal recessive persistent hyperplasia of the primary vitreous.
Prasov L, Masud T, Khaliq S, Mehdi SQ, Abid A, Oliver ER, Silva ED, Lewanda A, Brodsky MC, Borchert M, Kelberman D, Sowden JC, Dattani MT, Glaser T.
Human Molecular Genetics 2012 Aug; 21(16):3681.
Application:WB, Human, HEK 293T cells.
-
A Critical Analysis of Atoh7 (Math5) mRNA Splicing in the Developing Mouse Retina.
Prasov L, Brown NL, Glaser T.
PLoS One 2010 Aug; 5(8):e12315.
Application:WB-Ce, Mouse, Transfected NIH/3T3.
-
ATOH7 mutations cause autosomal recessive persistent hyperplasia of the primary vitreous.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com