Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UNC5B (Human) Recombinant Protein (Q01)

  • Catalog # : H00219699-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UNC5B partial ORF ( NP_734465, 27 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00219699-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • UNC5B
  • Gene Alias:
  • UNC5H2,p53RDL1
  • Gene Description:
  • unc-5 homolog B (C. elegans)
  • Gene Summary:
  • UNC5B belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000019772,p53-regulated receptor for death and life,transmembrane receptor Unc5H2,unc-5 homolog B,unc5 (C.elegans homolog) b
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook